journal
Journals Clinical & Developmental Immun...

Clinical & Developmental Immunology

https://read.qxmd.com/read/24454469/original-approach-for-automated-quantification-of-antinuclear-autoantibodies-by-indirect-immunofluorescence
#21
JOURNAL ARTICLE
Daniel Bertin, Noémie Jourde-Chiche, Pierre Bongrand, Nathalie Bardin
INTRODUCTION: Indirect immunofluorescence (IIF) is the gold standard method for the detection of antinuclear antibodies (ANA) which are essential markers for the diagnosis of systemic autoimmune rheumatic diseases. For the discrimination of positive and negative samples, we propose here an original approach named Immunofluorescence for Computed Antinuclear antibody Rational Evaluation (ICARE) based on the calculation of a fluorescence index (FI). METHODS: We made comparison between FI and visual evaluations on 237 consecutive samples and on a cohort of 25 patients with SLE...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24416061/a-new-elisa-for-dermatomyositis-autoantibodies-rapid-introduction-of-autoantigen-cdna-to-recombinant-assays-for-autoantibody-measurement
#22
REVIEW
Yoshinao Muro, Kazumitsu Sugiura, Masashi Akiyama
Advances in immunology, biochemistry, and molecular biology have enabled the development of a number of assays for measuring autoantibodies. ELISA has been widely used, because it can deal with relatively large numbers of serum samples more quickly than other immunologic methods, such as immunoblotting and immunoprecipitation. Recombinant autoantigens, which are generally produced in E. coli using the relevant cloned cDNA, are necessary for ELISA. Conventional clinical ELISA tests are limited in their ability to purify proteins free of bacterial contaminants, and the process is labor intensive...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24416060/expression-and-function-of-the-homeostatic-molecule-del-1-in-endothelial-cells-and-the-periodontal-tissue
#23
JOURNAL ARTICLE
Jieun Shin, Kavita B Hosur, Kalyani Pyaram, Ravi Jotwani, Shuang Liang, Triantafyllos Chavakis, George Hajishengallis
Developmental endothelial locus-1 (Del-1) is an endothelial cell-secreted protein that limits the recruitment of neutrophils by antagonizing the interaction between the LFA-1 integrin on neutrophils and the intercellular adhesion molecule (ICAM)-1 on endothelial cells. Mice with genetic or age-associated Del-1 deficiency exhibit increased neutrophil infiltration in the periodontium resulting in inflammatory bone loss. Here we investigated additional novel mechanisms whereby Del-1 could interfere with neutrophil recruitment and inflammation...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24396389/anti-il-17-antibody-improves-hepatic-steatosis-by-suppressing-interleukin-17-related-fatty-acid-synthesis-and-metabolism
#24
JOURNAL ARTICLE
Weidong Shi, Qiang Zhu, Jian Gu, Xiaoshan Liu, Ling Lu, Xiaofeng Qian, Jian Shen, Feng Zhang, Guoqiang Li
To investigate the relationship between interleukin-17 and proteins involved in fatty acid metabolism with respect to alcoholic liver disease, male ICR mice were randomized into five groups: control, alcoholic liver disease (ALD) at 4 weeks, 8 weeks, and 12 weeks, and anti-IL-17 antibody treated ALD. A proteomic approach was adopted to investigate changes in liver proteins between control and ALD groups. The proteomic analysis was performed by two-dimensional difference gel electrophoresis. Spots of interest were subsequently subjected to nanospray ionization tandem mass spectrometry (MS/MS) for protein identification...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24386000/mesenchymal-stem-cells-in-immune-mediated-bone-marrow-failure-syndromes
#25
REVIEW
Maria-Christina Kastrinaki, Konstantia Pavlaki, Aristea K Batsali, Elisavet Kouvidi, Irene Mavroudi, Charalampos Pontikoglou, Helen A Papadaki
Immune-mediated bone marrow failure syndromes (BMFS) are characterized by ineffective marrow haemopoiesis and subsequent peripheral cytopenias. Ineffective haemopoiesis is the result of a complex marrow deregulation including genetic, epigenetic, and immune-mediated alterations in haemopoietic stem/progenitor cells, as well as abnormal haemopoietic-to-stromal cell interactions, with abnormal release of haemopoietic growth factors, chemokines, and inhibitors. Mesenchymal stem/stromal cells (MSCs) and their progeny (i...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24382974/neuroendocrine-immunoregulation-in-multiple-sclerosis
#26
REVIEW
Nathalie Deckx, Wai-Ping Lee, Zwi N Berneman, Nathalie Cools
Currently, it is generally accepted that multiple sclerosis (MS) is a complex multifactorial disease involving genetic and environmental factors affecting the autoreactive immune responses that lead to damage of myelin. In this respect, intrinsic or extrinsic factors such as emotional, psychological, traumatic, or inflammatory stress as well as a variety of other lifestyle interventions can influence the neuroendocrine system. On its turn, it has been demonstrated that the neuroendocrine system has immunomodulatory potential...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24382973/effects-of-muscarinic-acetylcholine-3-receptor-208-227-peptide-immunization-on-autoimmune-response-in-nonobese-diabetic-mice
#27
JOURNAL ARTICLE
Lin Yang, Jinzhe Ju, Wei Zhang, Fengfeng Lv, Chunyan Pang, Guoan Yang, Yongfu Wang
The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205-237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certain autoimmune disorders, including Sjögren's syndrome (SS). Autoantibodies against M3R(228-237) have been shown to interfere with the function of M3R. However, few studies have been performed on the M3R(205-227) peptide of the second extracellular loop. In the current study, we sought to investigate the effect of M3R(208-227) peptide immunization on autoimmune response in NOD/LtJ mice...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24382972/interleukin-17-a-promoter-in-colorectal-cancer-progression
#28
REVIEW
Dang Wu, Pin Wu, Qi Huang, Yang Liu, Jun Ye, Jian Huang
It is widely accepted that chronic inflammation plays an active role in cancer. Inflammatory immunocytes and related cytokines in the tumor microenvironment are supposed to be a "double-edged sword" in colorectal cancer (CRC) initiation and progression. Interleukin-17 (IL-17), a pleiotropic proinflammatory cytokine, can promote cancer-elicited inflammation and prevent cancer cells from immune surveillance. Despite controversy, IL-17 is generally considered to be a promoter in CRC progression. In this review, we devote to summarize the current progress regarding the role of IL-17 in tumor initiation and progression, as well as the prognostic value in CRC...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24382971/chemokines-in-chronic-liver-allograft-dysfunction-pathogenesis-and-potential-therapeutic-targets
#29
REVIEW
Bin Liu, Jing Li, Lu-Nan Yan
Despite advances in immunosuppressive drugs, long-term success of liver transplantation is still limited by the development of chronic liver allograft dysfunction. Although the exact pathogenesis of chronic liver allograft dysfunction remains to be established, there is strong evidence that chemokines are involved in organ damage induced by inflammatory and immune responses after liver surgery. Chemokines are a group of low-molecular-weight molecules whose function includes angiogenesis, haematopoiesis, mitogenesis, organ fibrogenesis, tumour growth and metastasis, and participating in the development of the immune system and in inflammatory and immune responses...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24382970/autologous-cik-cell-immunotherapy-in-patients-with-renal-cell-carcinoma-after-radical-nephrectomy
#30
RANDOMIZED CONTROLLED TRIAL
Yajing Zhang, Jin Wang, Yao Wang, Xue-Chun Lu, Hui Fan, Yang Liu, Yan Zhang, Kai-Chao Feng, Wen-Ying Zhang, Mei-Xia Chen, Xiaobing Fu, Wei-Dong Han
OBJECTIVE: To evaluate the efficacy of autologous cytokine-induced killer (CIK) cells in patients with renal cell carcinoma (RCC). METHODS: 20 patients diagnosed with TNM stage I or II RCC were randomly divided into two groups, a CIK cell treatment group and a control group. The endpoint was progression-free survival (PFS) evaluated by Kaplan-Meier analyses. RESULTS: CD3(+), CD3(+)/CD8(+), CD3(+)/CD4(+), and CD3(+)/CD56(+) levels increased after CIK cell culture (P < 0...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24376466/highlights-on-novel-technologies-for-the-detection-of-antibodies-to-ro60-ro52-and-ss-b
#31
JOURNAL ARTICLE
M Infantino, C Bentow, A Seaman, M Benucci, F Atzeni, P Sarzi-Puttini, B Olivito, F Meacci, M Manfredi, M Mahler
OBJECTIVE: We aimed to compare a chemiluminescent immunoassay (CIA, QUANTA Flash) on BIO-FLASH with a multiplex flow immunoassay (MFI) on BioPlex 2200 for the detection of antibodies to Ro60, Ro52, and SS-B. METHODS: The study included 241 samples, from patients suffering from systemic autoimmune diseases (n = 108) as well as disease controls (n = 133). All samples were tested for anti-Ro52, anti-Ro60, and anti-SS-B (La) antibodies on QUANTA Flash (INOVA Diagnostics, San Diego, USA) and BioPlex 2200 (Bio-Rad Laboratories Inc...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24376465/viruses-and-immunity-in-transplant-patients
#32
EDITORIAL
Rossana Cavallo, Guido Antonelli, Hans H Hirsch
No abstract text is available yet for this article.
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24376464/immune-response-to-mycobacterial-infection-lessons-from-flow-cytometry
#33
REVIEW
Nikoletta Rovina, Marios Panagiotou, Konstantinos Pontikis, Magdalini Kyriakopoulou, Nikolaos G Koulouris, Antonia Koutsoukou
Detecting and treating active and latent tuberculosis are pivotal elements for effective infection control; yet, due to their significant inherent limitations, the diagnostic means for these two stages of tuberculosis (TB) to date remain suboptimal. This paper reviews the current diagnostic tools for mycobacterial infection and focuses on the application of flow cytometry as a promising method for rapid and reliable diagnosis of mycobacterial infection as well as discrimination between active and latent TB: it summarizes diagnostic biomarkers distinguishing the two states of infection and also features of the distinct immune response against Mycobacterium tuberculosis (Mtb) at certain stages of infection as revealed by flow cytometry to date...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24371450/elevated-1-%C3%AE-hydroxylase-activity-in-monocytes-from-patients-with-active-tuberculosis
#34
JOURNAL ARTICLE
Yi-Ching Tung, Tsan-Teng Ou, Wen-Chan Tsai
A uremic patient developed hypercalcemia after tuberculosis infection, and his ionized calcium levels correlated with 1,25-dihydroxyvitamin D3 (1,25(OH)2D3) levels. We performed further studies to determine whether monocytes are alternative sites of 1,25(OH)2D3 conversion beyond renal tubular cells. Using an ex vivo bioassay, in this study, we found that 1- α hydroxylase (CYP27B1) activity in monocytes is significantly higher in patients with active tuberculosis (TB) than in those with frequent TB contact...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24371449/radioimmunotherapy-combined-with-maintenance-anti-cd20-antibody-may-trigger-long-term-protective-t-cell-immunity-in-follicular-lymphoma-patients
#35
REVIEW
Franz Buchegger, Steven M Larson, Jean-Pierre Mach, Yves Chalandon, Pierre-Yves Dietrich, Anne Cairoli, John O Prior, Pedro Romero, Daniel E Speiser
Growing evidence suggests that the patient's immune response may play a major role in the long-term efficacy of antibody therapies of follicular lymphoma (FL). Particular long-lasting recurrence free survivals have been observed after first line, single agent rituximab or after radioimmunotherapy (RIT). Rituximab maintenance, furthermore, has a major efficacy in prolonging recurrence free survival after chemotherapy. On the other hand, RIT as a single step treatment showed a remarkable capacity to induce complete and partial remissions when applied in recurrence and as initial treatment of FL or given for consolidation...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24371448/antigen-specific-gene-therapy-after-immunisation-reduces-the-severity-of-collagen-induced-arthritis
#36
JOURNAL ARTICLE
Tove Eneljung, Sara Tengvall, Pernilla Jirholt, Louise Henningsson, Rikard Holmdahl, Kenth Gustafsson, Inger Gjertsson
Reestablishment of tolerance induction in rheumatoid arthritis (RA) would be an optimal treatment with few, if any, side effects. However, to develop such a treatment further insights in the immunological mechanisms governing tolerance are needed. We have developed a model of antigen-specific tolerance in collagen type II (CII) induced arthritis (CIA) using lentivirus-based gene therapy. The immunodominant epitope of CII was inserted into a lentivirus vector to achieve expression on the MHC class II molecule and the lentiviral particles were subsequently intravenously injected at different time points during CIA...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24371447/propofol-reduces-lipopolysaccharide-induced-nadph-oxidase-nox-2-mediated-tnf-%C3%AE-and-il-6-production-in-macrophages
#37
JOURNAL ARTICLE
Tao Meng, Jingya Yu, Zhen Lei, Jianbo Wu, Shuqin Wang, Qiyu Bo, Xinyu Zhang, Zhiyong Ma, Jingui Yu
During an infection, lipopolysaccharide (LPS) stimulates the production of reactive oxygen species (ROS), which is mediated, in large part, by nicotinamide adenine dinucleotide phosphate (NADPH) oxidases (NOXs); NOX2 is the major NOX isoform found in the macrophage cell membrane. While the immunomodulatory activity of propofol is highly documented, its effect on the LPS-induced NOX2/ROS/NF-κB signaling pathway in macrophages has not been addressed. In present study, we used murine macrophage cell line RAW264...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24371446/efficacy-and-safety-of-iguratimod-for-the-treatment-of-rheumatoid-arthritis
#38
REVIEW
Jiangtao Li, Hejuan Mao, Yan Liang, Yanrong Lu, Shuo Chen, Nanping Yang, Guixiu Shi
All randomized controlled trials (RCTs) of iguratimod for rheumatoid arthritis (RA) to assess its efficacy and safety are included in this paper. The Review Manager software was used for meta-analysis to assess risk bias of the studies included, and GRADE profiler software was used for the evidence quality of the studies included. Four RCTs involving 1407 patients with RA were included. Meta-analyses showed that, after 24-week therapy, ACR20, tender joint count, swollen joint count, rest pain, physician and patient global assessment of disease activity, HAQ score, ESR, and CRP in iguratimod group were better than those in placebo group and that the difference between those of iguratimod group and those of other DMARDs (MTX and SASP) group was not significant...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24371445/combinations-of-tlr-ligands-a-promising-approach-in-cancer-immunotherapy
#39
JOURNAL ARTICLE
Saskia Stier, Claudia Maletzki, Ulrike Klier, Michael Linnebacher
Toll-like receptors (TLRs), a family of pattern recognition receptors recognizing molecules expressed by pathogens, are typically expressed by immune cells. However, several recent studies revealed functional TLR expression also on tumor cells. Their expression is a two-sided coin for tumor cells. Not only tumor-promoting effects of TLR ligands are described but also direct oncopathic and immunostimulatory effects. To clarify TLRs' role in colorectal cancer (CRC), we tested the impact of the TLR ligands LPS, Poly I:C, R848, and Taxol on primary human CRC cell lines (HROC40, HROC60, and HROC69) in vitro and in vivo (CT26)...
2013: Clinical & Developmental Immunology
https://read.qxmd.com/read/24369475/anti-hla-and-anti-mica-antibodies-in-liver-transplant-recipients-effect-on-long-term-graft-survival
#40
JOURNAL ARTICLE
Michał Ciszek, Bartosz Foroncewicz, Krzysztof Mucha, Dorota Żochowska, Bogna Ziarkiewicz-Wróblewska, Marek Krawczyk, Leszek Pączek
OBJECTIVE: Presence of anti-HLA antibodies has a well-known impact on kidney grafts survival; however their role in liver transplantation has not been fully elucidated. We conducted a 7-year prospective study to show correlation between presence of anti-HLA and anti-MICA antibodies and liver graft survival. METHODS: Blood samples from 123 liver transplant recipients were collected during patients routine visits. Time from transplantation to blood sample collection was different for each patient...
2013: Clinical & Developmental Immunology
journal
journal
40482
2
3
Fetch more papers »
Fetching more papers... Fetching...
Remove bar
Read by QxMD icon Read
×

Save your favorite articles in one place with a free QxMD account.

×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"

We want to hear from doctors like you!

Take a second to answer a survey question.